Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (10 species) not a true protein |
Species Cryptosporidium hominis [TaxId:237895] [256376] (1 PDB entry) |
Domain d4odja1: 4odj A:21-130 [254049] automated match to d2p02a1 complexed with 3po, mg, sam |
PDB Entry: 4odj (more details), 1.6 Å
SCOPe Domain Sequences for d4odja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odja1 d.130.1.0 (A:21-130) automated matches {Cryptosporidium hominis [TaxId: 237895]} eqflfssesvcsghpdklcdqisdaildacleqdpesfvacetctktgfimvfgeittka nvnyervvretvkeigydseekgldyktmdviikleqqsnqiagcvhvdk
Timeline for d4odja1: