Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries) |
Domain d4o5hd_: 4o5h D: [254042] Other proteins in same PDB: d4o5ha2, d4o5hb2 automated match to d3k2wb_ complexed with edo, gol, na |
PDB Entry: 4o5h (more details), 2 Å
SCOPe Domain Sequences for d4o5hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o5hd_ c.82.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} tfalldatraflakpkqmligaewsdaasgrqldvvnpadgtviarvpeaderdvqqava aarrafdagpwrtakttdrerlmlvladlieanarelaeiesldngkpvmvaqgldvama aqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvgaiipwnfpllmaawki apalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgyghtagaalsrdprid kiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldkaaqgvanaiffnqgq vctagsrayihskvfdgviervakiaaslkigpgmdpatqigplvsakqrervcgyidsg fgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvlvampfddvdtavqla ndtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpfggmkqsgfgrelgra vidqytesksvmmnya
Timeline for d4o5hd_: