![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
![]() | Domain d4ny0d1: 4ny0 D:34-130 [254037] Other proteins in same PDB: d4ny0a2, d4ny0a3, d4ny0b2, d4ny0b3, d4ny0d2, d4ny0d3 automated match to d2al6b3 |
PDB Entry: 4ny0 (more details), 2.8 Å
SCOPe Domain Sequences for d4ny0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ny0d1 d.15.1.0 (D:34-130) automated matches {Human (Homo sapiens) [TaxId: 9606]} ervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlshlrse evhwlhvdmgvssvrekyelahppeewkyelrirylp
Timeline for d4ny0d1: