Lineage for d4ny0b3 (4ny0 B:254-362)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (62 PDB entries)
  8. 2395073Domain d4ny0b3: 4ny0 B:254-362 [254036]
    Other proteins in same PDB: d4ny0a1, d4ny0a2, d4ny0b1, d4ny0b2, d4ny0d1, d4ny0d2
    automated match to d2al6a2

Details for d4ny0b3

PDB Entry: 4ny0 (more details), 2.8 Å

PDB Description: Crystal structure of FERM domain of human focal adhesion kinase
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4ny0b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ny0b3 b.55.1.0 (B:254-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkecfkcalgsswiisvelaigpeegisyltdkgcnpthladftqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngtsqsfiirp

SCOPe Domain Coordinates for d4ny0b3:

Click to download the PDB-style file with coordinates for d4ny0b3.
(The format of our PDB-style files is described here.)

Timeline for d4ny0b3: