Lineage for d4ny0b1 (4ny0 B:34-130)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638535Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)
  8. 1638579Domain d4ny0b1: 4ny0 B:34-130 [254034]
    Other proteins in same PDB: d4ny0a2, d4ny0a3, d4ny0b2, d4ny0b3, d4ny0d2, d4ny0d3
    automated match to d2al6b3

Details for d4ny0b1

PDB Entry: 4ny0 (more details), 2.8 Å

PDB Description: Crystal structure of FERM domain of human focal adhesion kinase
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4ny0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ny0b1 d.15.1.0 (B:34-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlshlrse
evhwlhvdmgvssvrekyelahppeewkyelrirylp

SCOPe Domain Coordinates for d4ny0b1:

Click to download the PDB-style file with coordinates for d4ny0b1.
(The format of our PDB-style files is described here.)

Timeline for d4ny0b1: