Lineage for d4ny0a1 (4ny0 A:34-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933310Domain d4ny0a1: 4ny0 A:34-130 [254031]
    Other proteins in same PDB: d4ny0a2, d4ny0a3, d4ny0b2, d4ny0b3, d4ny0d2, d4ny0d3
    automated match to d2al6b3

Details for d4ny0a1

PDB Entry: 4ny0 (more details), 2.8 Å

PDB Description: Crystal structure of FERM domain of human focal adhesion kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4ny0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ny0a1 d.15.1.0 (A:34-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlshlrse
evhwlhvdmgvssvrekyelahppeewkyelrirylp

SCOPe Domain Coordinates for d4ny0a1:

Click to download the PDB-style file with coordinates for d4ny0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ny0a1: