SCOPe 2.04: Domain d4nrje_: 4nrj E:

Lineage for d4nrje_ (4nrj E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza b virus [TaxId:11520] [188441] (4 PDB entries)

8. Domain d4nrje_: 4nrj E: [254018]
   Other proteins in same PDB: d4nrjb_, d4nrjd_, d4nrjf_
   automated match to d4nrla_
   complexed with nag; mutant

Details for d4nrje_

PDB Entry: 4nrj, 2.53 Å

PDB Description: structure of hemagglutinin with f95y mutation of influenza virus b/lee/40

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4nrje_:

Sequence; same for both SEQRES and ATOM records:

>d4nrje_ b.19.1.2 (E:) Hemagglutinin {Influenza b virus}
drictgitssnsphvvktatqgevnvtgvipltttptrshfanlkgtqtrgklcpncfnc
tdldvalgrpkcmgnipsakvsilhevkpvtsgcypimhdrtkirqlpnllrgyenirls
tsnvintetapggpykvgtsgscpnvtngngffntmawvipkdnnkiainpvtvevpyic
segedqitvwgfhsddktqmerlygdsnpqkftssangvtthyvsqiggfpnqtedeglk
qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
glnkskpyytgehakaigncpiwvktplklangtkyrppak

Timeline for d4nrje_:

• d4nrje_ is new in SCOPe 2.04-stable
  
• d4nrje_ appears in SCOPe 2.05
  
• d4nrje_ appears in the current release, SCOPe 2.08