SCOPe 2.04: Domain d4nogb_: 4nog B:

Lineage for d4nogb_ (4nog B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (83 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:508771] [256372] (1 PDB entry)

8. Domain d4nogb_: 4nog B: [254011]
   automated match to d1z7da1
   complexed with act, bme, btb, peg, plp

Details for d4nogb_

PDB Entry: 4nog, 1.2 Å

PDB Description: crystal structure of a putative ornithine aminotransferase from toxoplasma gondii me49 in complex with pyrodoxal-5'-phosphate

PDB Compounds: (B:) Putative ornithine aminotransferase, mitochondrial

SCOPe Domain Sequences for d4nogb_:

Sequence; same for both SEQRES and ATOM records:

>d4nogb_ c.67.1.0 (B:) automated matches {Toxoplasma gondii [TaxId: 508771]}
arktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfl
agvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntg
aeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftp
gfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlliv
deiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgst
fggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllna
vevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflave
eerk

Timeline for d4nogb_:

• d4nogb_ is new in SCOPe 2.04-stable
  
• d4nogb_ appears in SCOPe 2.05
  
• d4nogb_ appears in the current release, SCOPe 2.08