Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4no6u_: 4no6 U: [254004] Other proteins in same PDB: d4no6a_, d4no6c_, d4no6e_, d4no6f_, d4no6i_, d4no6j_, d4no6k_, d4no6l_, d4no6n_, d4no6o_, d4no6q_, d4no6s_, d4no6t_, d4no6w_, d4no6x_, d4no6y_, d4no6z_ automated match to d1rypa_ complexed with 2m1, mg |
PDB Entry: 4no6 (more details), 3 Å
SCOPe Domain Sequences for d4no6u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no6u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d4no6u_: