SCOPe 2.05: Domain d4no6j_: 4no6 J:

Lineage for d4no6j_ (4no6 J:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4no6j_: 4no6 J: [253994]
   Other proteins in same PDB: d4no6b_, d4no6c_, d4no6f_, d4no6g_, d4no6h_, d4no6m_, d4no6p_, d4no6q_, d4no6t_, d4no6u_, d4no6v_
   automated match to d4j70j_
   complexed with 2m1, mg

Details for d4no6j_

PDB Entry: 4no6, 3 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-vinylsulfone

PDB Compounds: (J:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4no6j_:

Sequence; same for both SEQRES and ATOM records:

>d4no6j_ d.153.1.4 (J:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

Timeline for d4no6j_:

• d4no6j_ first appeared in SCOPe 2.04
  
• d4no6j_ appears in SCOPe 2.06
  
• d4no6j_ appears in the current release, SCOPe 2.08