Lineage for d4nhfd_ (4nhf D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937184Species Bartonella grahamii [TaxId:634504] [256352] (2 PDB entries)
  8. 2937188Domain d4nhfd_: 4nhf D: [253956]
    automated match to d2bhma1
    complexed with ca

Details for d4nhfd_

PDB Entry: 4nhf (more details), 2 Å

PDB Description: crystal structure of the soluble domain of trwg type iv secretion machinery from bartonella grahamii
PDB Compounds: (D:) TrwG protein

SCOPe Domain Sequences for d4nhfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhfd_ d.17.4.0 (D:) automated matches {Bartonella grahamii [TaxId: 634504]}
etsygevvdrywlnqyvlnrenydydtiqlnydttallsaasvqqeyykiydgenardkv
lsnkaritvkvrsiqlnglgqatvrfttqqldssgattgpkqhqiatigytyvgapmkss
drllnplgfqitsyrsdpeill

SCOPe Domain Coordinates for d4nhfd_:

Click to download the PDB-style file with coordinates for d4nhfd_.
(The format of our PDB-style files is described here.)

Timeline for d4nhfd_: