Lineage for d4ndmb1 (4ndm B:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759100Domain d4ndmb1: 4ndm B:1-121 [253937]
    Other proteins in same PDB: d4ndma2, d4ndma3, d4ndmb2
    automated match to d2f54d1

Details for d4ndmb1

PDB Entry: 4ndm (more details), 3.01 Å

PDB Description: structure of the ab18.1 tcr
PDB Compounds: (B:) human nkt tcr alpha chain

SCOPe Domain Sequences for d4ndmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndmb1 b.1.1.0 (B:1-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaks
grysvnfkkaaksvaltisalqledsakyfcalgdqilywglshtdklifgkgtrvtvep
n

SCOPe Domain Coordinates for d4ndmb1:

Click to download the PDB-style file with coordinates for d4ndmb1.
(The format of our PDB-style files is described here.)

Timeline for d4ndmb1: