SCOPe 2.07: Domain d4natb_: 4nat B:

Lineage for d4natb_ (4nat B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (59 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries)

8. Domain d4natb_: 4nat B: [253932]
   automated match to d4naua_
   complexed with 2w5, adp, epe

Details for d4natb_

PDB Entry: 4nat, 1.72 Å

PDB Description: Inhibitors of 4-Phosphopanthetheine Adenylyltransferase

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4natb_:

Sequence, based on SEQRES records:

>d4natb_ c.26.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfk

Sequence, based on observed residues (ATOM records):

>d4natb_ c.26.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlkegtfsleermdlieqsvkhlp
nvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymmsstn
ysfisssivkevaayradisefvppyvekalkkkfk

Timeline for d4natb_:

• d4natb_ first appeared in SCOPe 2.04
  
• d4natb_ appears in SCOPe 2.06
  
• d4natb_ appears in the current release, SCOPe 2.08