Lineage for d4nahf_ (4nah F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590865Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries)
  8. 1590874Domain d4nahf_: 4nah F: [253930]
    automated match to d4naua_
    complexed with 2vj, ags

Details for d4nahf_

PDB Entry: 4nah (more details), 2.38 Å

PDB Description: Inhibitors of 4-Phosphopanthetheine Adenylyltransferase (PPAT)
PDB Compounds: (F:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4nahf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nahf_ c.26.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfk

SCOPe Domain Coordinates for d4nahf_:

Click to download the PDB-style file with coordinates for d4nahf_.
(The format of our PDB-style files is described here.)

Timeline for d4nahf_: