Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (33 species) not a true protein |
Species Streptococcus sanguinis [TaxId:388919] [256369] (1 PDB entry) |
Domain d4n83h_: 4n83 H: [253924] automated match to d2r2fa_ complexed with mn |
PDB Entry: 4n83 (more details), 2.65 Å
SCOPe Domain Sequences for d4n83h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n83h_ a.25.1.0 (H:) automated matches {Streptococcus sanguinis [TaxId: 388919]} yykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfgglt lldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifaw tntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvaei ikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydtv gwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
Timeline for d4n83h_: