Lineage for d4n83d_ (4n83 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1730287Species Streptococcus sanguinis [TaxId:388919] [256369] (1 PDB entry)
  8. 1730291Domain d4n83d_: 4n83 D: [253920]
    automated match to d2r2fa_
    complexed with mn

Details for d4n83d_

PDB Entry: 4n83 (more details), 2.65 Å

PDB Description: x-ray crystal structure of streptococcus sanguinis dimanganese(ii)- nrdf
PDB Compounds: (D:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4n83d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n83d_ a.25.1.0 (D:) automated matches {Streptococcus sanguinis [TaxId: 388919]}
tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis

SCOPe Domain Coordinates for d4n83d_:

Click to download the PDB-style file with coordinates for d4n83d_.
(The format of our PDB-style files is described here.)

Timeline for d4n83d_: