Lineage for d4n5yh1 (4n5y H:1-174)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041411Domain d4n5yh1: 4n5y H:1-174 [253888]
    Other proteins in same PDB: d4n5ya1, d4n5ya2, d4n5yb2, d4n5yc1, d4n5yc2, d4n5yd2, d4n5ye1, d4n5ye2, d4n5yf2, d4n5yg1, d4n5yg2, d4n5yh2, d4n5yi1, d4n5yi2, d4n5yj2, d4n5yk1, d4n5yk2, d4n5yl2, d4n5ym1, d4n5ym2, d4n5yn2, d4n5yo1, d4n5yo2, d4n5yp2, d4n5yq1, d4n5yq2, d4n5yr2, d4n5ys1, d4n5ys2, d4n5yt2, d4n5yu1, d4n5yu2, d4n5yv2, d4n5yw1, d4n5yw2, d4n5yx2, d4n5yy1, d4n5yy2, d4n5yz2
    automated match to d4n5zb_
    complexed with nag; mutant

Details for d4n5yh1

PDB Entry: 4n5y (more details), 3.16 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n158d, n224k and q226l) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (H:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4n5yh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5yh1 h.3.1.1 (H:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d4n5yh1:

Click to download the PDB-style file with coordinates for d4n5yh1.
(The format of our PDB-style files is described here.)

Timeline for d4n5yh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n5yh2
View in 3D
Domains from other chains:
(mouse over for more information)
d4n5ya1, d4n5ya2, d4n5yb1, d4n5yb2, d4n5yc1, d4n5yc2, d4n5yd1, d4n5yd2, d4n5ye1, d4n5ye2, d4n5yf1, d4n5yf2, d4n5yg1, d4n5yg2, d4n5yi1, d4n5yi2, d4n5yj1, d4n5yj2, d4n5yk1, d4n5yk2, d4n5yl1, d4n5yl2, d4n5ym1, d4n5ym2, d4n5yn1, d4n5yn2, d4n5yo1, d4n5yo2, d4n5yp1, d4n5yp2, d4n5yq1, d4n5yq2, d4n5yr1, d4n5yr2, d4n5ys1, d4n5ys2, d4n5yt1, d4n5yt2, d4n5yu1, d4n5yu2, d4n5yv1, d4n5yv2, d4n5yw1, d4n5yw2, d4n5yx1, d4n5yx2, d4n5yy1, d4n5yy2, d4n5yz1, d4n5yz2