Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) |
Family b.40.4.7: Phage ssDNA-binding proteins [50315] (3 proteins) barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms |
Protein Gene V protein [50316] (2 species) |
Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries) |
Domain d2gvbb_: 2gvb B: [25388] mutant |
PDB Entry: 2gvb (more details)
SCOP Domain Sequences for d2gvbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvbb_ b.40.4.7 (B:) Gene V protein {Filamentous bacteriophage (f1, M13)} mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl ytvhlssfkvgqfgslmidrlrlvpak
Timeline for d2gvbb_: