![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d4n0fl_: 4n0f L: [253862] Other proteins in same PDB: d4n0fa1, d4n0fa2, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe1, d4n0fe2, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh1, d4n0fh2, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk1, d4n0fk2, d4n0fm1, d4n0fm2, d4n0fm3 automated match to d1k5nb_ |
PDB Entry: 4n0f (more details), 3.02 Å
SCOPe Domain Sequences for d4n0fl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0fl_ b.1.1.2 (L:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d4n0fl_: