Lineage for d4n0fh1 (4n0f H:4-176)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642652Protein automated matches [191280] (3 species)
    not a true protein
  7. 1642659Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)
  8. 1642698Domain d4n0fh1: 4n0f H:4-176 [253854]
    Other proteins in same PDB: d4n0fa2, d4n0fb_, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe2, d4n0ff_, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh2, d4n0fi_, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk2, d4n0fl_, d4n0fm1, d4n0fm2, d4n0fm3
    automated match to d1exua2

Details for d4n0fh1

PDB Entry: 4n0f (more details), 3.02 Å

PDB Description: Human FcRn complexed with human serum albumin
PDB Compounds: (H:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d4n0fh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0fh1 d.19.1.1 (H:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

SCOPe Domain Coordinates for d4n0fh1:

Click to download the PDB-style file with coordinates for d4n0fh1.
(The format of our PDB-style files is described here.)

Timeline for d4n0fh1: