Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (369 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4n0ff_: 4n0f F: [253850] Other proteins in same PDB: d4n0fa1, d4n0fa2, d4n0fd1, d4n0fd2, d4n0fd3, d4n0fe1, d4n0fe2, d4n0fg1, d4n0fg2, d4n0fg3, d4n0fh1, d4n0fh2, d4n0fj1, d4n0fj2, d4n0fj3, d4n0fk1, d4n0fk2, d4n0fm1, d4n0fm2, d4n0fm3 automated match to d1k5nb_ |
PDB Entry: 4n0f (more details), 3.02 Å
SCOPe Domain Sequences for d4n0ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0ff_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d4n0ff_: