SCOPe 2.04: Domain d4n0af_: 4n0a F:

Lineage for d4n0af_ (4n0a F:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (6 PDB entries)

8. Domain d4n0af_: 4n0a F: [253840]
   automated match to d3bw1a_
   protein/RNA complex

Details for d4n0af_

PDB Entry: 4n0a, 3.15 Å

PDB Description: Crystal structure of Lsm2-3-Pat1C complex from Saccharomyces cerevisiae

PDB Compounds: (F:) U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d4n0af_:

Sequence, based on SEQRES records:

>d4n0af_ b.38.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
rrcemvfirgdtvtlistp

Sequence, based on observed residues (ATOM records):

>d4n0af_ b.38.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnseserrce
mvfirgdtvtlistp

Timeline for d4n0af_:

• d4n0af_ is new in SCOPe 2.04-stable
  
• d4n0af_ appears in SCOPe 2.05
  
• d4n0af_ appears in the current release, SCOPe 2.08