Lineage for d4n0ac_ (4n0a C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787484Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (5 PDB entries)
  8. 2787506Domain d4n0ac_: 4n0a C: [253837]
    automated match to d4m78b_
    protein/RNA complex

Details for d4n0ac_

PDB Entry: 4n0a (more details), 3.15 Å

PDB Description: Crystal structure of Lsm2-3-Pat1C complex from Saccharomyces cerevisiae
PDB Compounds: (C:) u6 snrna-associated sm-like protein lsm2

SCOPe Domain Sequences for d4n0ac_:

Sequence, based on SEQRES records: (download)

>d4n0ac_ b.38.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdekkyphlgsvrni
firgstvryvylnknmvdtnllqdatrrevmte

Sequence, based on observed residues (ATOM records): (download)

>d4n0ac_ b.38.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdesvrnifirgstv
ryvylnknmvdtnllqdatrrevmte

SCOPe Domain Coordinates for d4n0ac_:

Click to download the PDB-style file with coordinates for d4n0ac_.
(The format of our PDB-style files is described here.)

Timeline for d4n0ac_: