Lineage for d4n0ab_ (4n0a B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (14 species)
    not a true protein
  7. 2381090Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries)
  8. 2381118Domain d4n0ab_: 4n0a B: [253836]
    automated match to d3bw1a_
    protein/RNA complex

Details for d4n0ab_

PDB Entry: 4n0a (more details), 3.15 Å

PDB Description: Crystal structure of Lsm2-3-Pat1C complex from Saccharomyces cerevisiae
PDB Compounds: (B:) U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d4n0ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0ab_ b.38.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
rrcemvfirgdtvtlistps

SCOPe Domain Coordinates for d4n0ab_:

Click to download the PDB-style file with coordinates for d4n0ab_.
(The format of our PDB-style files is described here.)

Timeline for d4n0ab_: