SCOPe 2.04: Domain d4mrqa4: 4mrq A:368-463

Lineage for d4mrqa4 (4mrq A:368-463)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families)
   contains a single copy of this fold and an extra beta-strand at the C-terminus

5. Family d.129.2.0: automated matches [254315] (1 protein)
   not a true family

6. Protein automated matches [254722] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [256305] (2 PDB entries)

8. Domain d4mrqa4: 4mrq A:368-463 [253830]
   Other proteins in same PDB: d4mrqa1, d4mrqa2, d4mrqa3
   automated match to d1p5dx4
   complexed with edo, peg, pge, tla, zn

Details for d4mrqa4

PDB Entry: 4mrq, 1.9 Å

PDB Description: Crystal Structure of wild-type unphosphorylated PMM/PGM

PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4mrqa4:

Sequence; same for both SEQRES and ATOM records:

>d4mrqa4 d.129.2.0 (A:368-463) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

Timeline for d4mrqa4:

• d4mrqa4 is new in SCOPe 2.04-stable
  
• d4mrqa4 appears in SCOPe 2.05
  
• d4mrqa4 appears in the current release, SCOPe 2.08