SCOPe 2.04: Domain d4mngf2: 4mng F:147-256

Lineage for d4mngf2 (4mng F:147-256)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4mngf2: 4mng F:147-256 [253816]
   Other proteins in same PDB: d4mnga1, d4mnga2, d4mngb_, d4mngc1, d4mngc2, d4mngd_
   automated match to d4mayc1
   complexed with cis, nag

Details for d4mngf2

PDB Entry: 4mng, 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide

PDB Compounds: (F:) TRA@ protein, Ti antigen CD3-associated protein gamma chain V-J-C region

SCOPe Domain Sequences for d4mngf2:

Sequence; same for both SEQRES and ATOM records:

>d4mngf2 b.1.1.0 (F:147-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksvirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvlesgispgk
ydtygstrknlrmilrnliendsgvyycatwdekyykklfgsgtkliitd

Timeline for d4mngf2:

• d4mngf2 is new in SCOPe 2.04-stable
  
• d4mngf2 appears in SCOPe 2.05
  
• d4mngf2 appears in the current release, SCOPe 2.08