SCOPe 2.06: Domain d4mnge2: 4mng E:147-256

Lineage for d4mnge2 (4mng E:147-256)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4mnge2: 4mng E:147-256 [253814]
   Other proteins in same PDB: d4mnga1, d4mnga2, d4mnga3, d4mngb_, d4mngc1, d4mngc2, d4mngc3, d4mngd_
   automated match to d4mayc1
   complexed with cis, nag

Details for d4mnge2

PDB Entry: 4mng, 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide

PDB Compounds: (E:) TRA@ protein, Ti antigen CD3-associated protein gamma chain V-J-C region

SCOPe Domain Sequences for d4mnge2:

Sequence; same for both SEQRES and ATOM records:

>d4mnge2 b.1.1.0 (E:147-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksvirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvlesgispgk
ydtygstrknlrmilrnliendsgvyycatwdekyykklfgsgtkliitd

Timeline for d4mnge2:

• d4mnge2 first appeared in SCOPe 2.04
  
• d4mnge2 appears in SCOPe 2.05
  
• d4mnge2 appears in SCOPe 2.07
  
• d4mnge2 appears in the current release, SCOPe 2.08