![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d4mnge1: 4mng E:2-119 [253813] Other proteins in same PDB: d4mnga1, d4mnga2, d4mnga3, d4mngb_, d4mngc1, d4mngc2, d4mngc3, d4mngd_ automated match to d4mayc1 complexed with cis, nag |
PDB Entry: 4mng (more details), 3.01 Å
SCOPe Domain Sequences for d4mnge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mnge1 b.1.1.0 (E:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg rysvnfkkaaksvaltisalqledsakyfcalgepsywgfprttrvifgkgtrvtvep
Timeline for d4mnge1: