Lineage for d4mnga2 (4mng A:184-278)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763464Domain d4mnga2: 4mng A:184-278 [253808]
    Other proteins in same PDB: d4mnga1, d4mngb_, d4mngc1, d4mngd_, d4mnge1, d4mnge2, d4mngf1, d4mngf2
    automated match to d3hujc2
    complexed with cis, nag

Details for d4mnga2

PDB Entry: 4mng (more details), 3.01 Å

PDB Description: structure of the dp10.7 tcr with cd1d-sulfatide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d, Cd1d1 protein

SCOPe Domain Sequences for d4mnga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mnga2 b.1.1.2 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyws

SCOPe Domain Coordinates for d4mnga2:

Click to download the PDB-style file with coordinates for d4mnga2.
(The format of our PDB-style files is described here.)

Timeline for d4mnga2: