Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries) |
Domain d4mnga1: 4mng A:6-183 [253807] Other proteins in same PDB: d4mnga2, d4mngb_, d4mngc2, d4mngd_, d4mnge1, d4mnge2, d4mngf1, d4mngf2 automated match to d3hujc1 complexed with cis, nag |
PDB Entry: 4mng (more details), 3.01 Å
SCOPe Domain Sequences for d4mnga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mnga1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d4mnga1: