Lineage for d4m9pa2 (4m9p A:574-669)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. 1524749Species Human (Homo sapiens) [TaxId:9606] [186988] (9 PDB entries)
  8. 1524751Domain d4m9pa2: 4m9p A:574-669 [253781]
    automated match to d2dica1

Details for d4m9pa2

PDB Entry: 4m9p (more details), 1.72 Å

PDB Description: Crystal structure of the human filamin A Ig-like domains 3-5
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d4m9pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9pa2 b.1.18.0 (A:574-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cgnqkvrawgpgleggvvgksadfvveaigddvgtlgfsvegpsqakiecddkgdgscdv
rywpqeageyavhvlcnsedirlspfmadirdapqd

SCOPe Domain Coordinates for d4m9pa2:

Click to download the PDB-style file with coordinates for d4m9pa2.
(The format of our PDB-style files is described here.)

Timeline for d4m9pa2: