Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
Domain d4m93l2: 4m93 L:108-213 [253779] Other proteins in same PDB: d4m93c1, d4m93l1 automated match to d4ma1l2 complexed with act, ca, nag |
PDB Entry: 4m93 (more details), 2.09 Å
SCOPe Domain Sequences for d4m93l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m93l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d4m93l2: