Lineage for d4m7jl1 (4m7j L:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024827Domain d4m7jl1: 4m7j L:1-107 [253769]
    Other proteins in same PDB: d4m7jl2
    automated match to d4ma1l1
    complexed with k, nag, peg

Details for d4m7jl1

PDB Entry: 4m7j (more details), 1.95 Å

PDB Description: crystal structure of s25-26 in complex with kdo(2.8)kdo(2.4)kdo trisaccharide
PDB Compounds: (L:) S25-26 Fab (Igg1k) Light Chain

SCOPe Domain Sequences for d4m7jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m7jl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelk

SCOPe Domain Coordinates for d4m7jl1:

Click to download the PDB-style file with coordinates for d4m7jl1.
(The format of our PDB-style files is described here.)

Timeline for d4m7jl1: