Lineage for d4m77g_ (4m77 G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539744Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1539745Protein automated matches [190914] (8 species)
    not a true protein
  7. 1539785Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (4 PDB entries)
  8. 1539793Domain d4m77g_: 4m77 G: [253762]
    automated match to d4m78n_
    protein/RNA complex

Details for d4m77g_

PDB Entry: 4m77 (more details), 3.11 Å

PDB Description: Crystal structure of Lsm2-8 complex, space group I212121
PDB Compounds: (G:) u6 snrna-associated sm-like protein lsm4

SCOPe Domain Sequences for d4m77g_:

Sequence, based on SEQRES records: (download)

>d4m77g_ b.38.1.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
skavklneiyirgtfikfiklqdnii

Sequence, based on observed residues (ATOM records): (download)

>d4m77g_ b.38.1.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklneiyirgtfi
kfiklqdnii

SCOPe Domain Coordinates for d4m77g_:

Click to download the PDB-style file with coordinates for d4m77g_.
(The format of our PDB-style files is described here.)

Timeline for d4m77g_: