SCOP 1.73: Domain d1vqda_: 1vqd A:

Lineage for d1vqda_ (1vqd A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.7: Phage ssDNA-binding proteins [50315] (3 proteins)
   barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms

6. Protein Gene V protein [50316] (2 species)

7. Species Enterobacteria phage M13, including coliphage f1 [TaxId:10870] [50317] (19 PDB entries)

8. Domain d1vqda_: 1vqd A: [25375]
   mutant

Details for d1vqda_

PDB Entry: 1vqd, 1.8 Å

PDB Description: gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by leu 47 (v35i, i47l)

PDB Compounds: (A:) gene v protein

SCOP Domain Sequences for d1vqda_:

Sequence; same for both SEQRES and ATOM records:

>d1vqda_ b.40.4.7 (A:) Gene V protein {Enterobacteria phage M13, including coliphage f1 [TaxId: 10870]}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyidlgneypvlvkltldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpa

Timeline for d1vqda_:

• d1vqda_ first appeared (with stable ids) in SCOP 1.55, called d1vqd__
  
• d1vqda_ was called d1vqd__ in SCOP 1.71
  
• d1vqda_ appears in SCOP 1.75
  
• d1vqda_ appears in the current release, SCOPe 2.08