Lineage for d4m4sa2 (4m4s A:207-320)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1544169Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 1544178Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
    Uniprot Q980A5 207-320
  8. 1544181Domain d4m4sa2: 4m4s A:207-320 [253747]
    Other proteins in same PDB: d4m4sa1, d4m4sa3
    automated match to d2qn6a1
    protein/RNA complex; complexed with fmt, gdp, mg, na

Details for d4m4sa2

PDB Entry: 4m4s (more details), 2.25 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion mimic aif2gamma*gdp*pi complex (a formate ion substitutes for pi)
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m4sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4sa2 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsadvnapgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissiafgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d4m4sa2:

Click to download the PDB-style file with coordinates for d4m4sa2.
(The format of our PDB-style files is described here.)

Timeline for d4m4sa2: