Lineage for d4m1hb1 (4m1h B:1-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703625Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)
  8. 2703627Domain d4m1hb1: 4m1h B:1-328 [253728]
    Other proteins in same PDB: d4m1ha2, d4m1hb2, d4m1hc2, d4m1hd2
    automated match to d2ania_

Details for d4m1hb1

PDB Entry: 4m1h (more details), 1.7 Å

PDB Description: X-ray crystal structure of Chlamydia trachomatis apo NrdB
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4m1hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1hb1 a.25.1.2 (B:1-328) automated matches {Chlamydia trachomatis [TaxId: 813]}
mqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgk
dielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafee
avhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqe
fvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidling
ikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrl
eriglkpiyhtknpfpwmsetidlnkek

SCOPe Domain Coordinates for d4m1hb1:

Click to download the PDB-style file with coordinates for d4m1hb1.
(The format of our PDB-style files is described here.)

Timeline for d4m1hb1: