SCOPe 2.08: Domain d4m1fa_: 4m1f A:

Lineage for d4m1fa_ (4m1f A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255975] (6 PDB entries)

8. Domain d4m1fa_: 4m1f A: [253726]
   automated match to d1uzrb_

Details for d4m1fa_

PDB Entry: 4m1f, 2 Å

PDB Description: x-ray crystal structure of e. coli apo nrdf

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 subunit beta

SCOPe Domain Sequences for d4m1fa_:

Sequence; same for both SEQRES and ATOM records:

>d4m1fa_ a.25.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
risainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftglt
lldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaw
seenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadl
irliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaet
pwaddvkaflcynankalmnlgyeplfpaemaevnpailaalsp

Timeline for d4m1fa_:

• d4m1fa_ first appeared in SCOPe 2.04
  
• d4m1fa_ appears in SCOPe 2.07