Lineage for d4m0lf3 (4m0l F:321-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793941Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 2793950Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
    Uniprot Q980A5 321-415
  8. 2793963Domain d4m0lf3: 4m0l F:321-415 [253725]
    Other proteins in same PDB: d4m0la1, d4m0la2, d4m0lb1, d4m0lb2, d4m0lc1, d4m0lc2, d4m0ld1, d4m0ld2, d4m0le1, d4m0le2, d4m0lf1, d4m0lf2
    automated match to d2qn6a2
    protein/RNA complex; complexed with gdp, mg, po4

Details for d4m0lf3

PDB Entry: 4m0l (more details), 2.6 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
PDB Compounds: (F:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m0lf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m0lf3 b.44.1.1 (F:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d4m0lf3:

Click to download the PDB-style file with coordinates for d4m0lf3.
(The format of our PDB-style files is described here.)

Timeline for d4m0lf3: