Class b: All beta proteins [48724] (176 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Initiation factor eIF2 gamma subunit [74964] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries) Uniprot Q980A5 321-415 |
Domain d4m0le3: 4m0l E:321-415 [253722] Other proteins in same PDB: d4m0la1, d4m0la2, d4m0lb1, d4m0lb2, d4m0lc1, d4m0lc2, d4m0ld1, d4m0ld2, d4m0le1, d4m0le2, d4m0lf1, d4m0lf2 automated match to d2qn6a2 protein/RNA complex; complexed with gdp, mg, po4 |
PDB Entry: 4m0l (more details), 2.6 Å
SCOPe Domain Sequences for d4m0le3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m0le3 b.44.1.1 (E:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d4m0le3: