Lineage for d4m0ld2 (4m0l D:207-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062785Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 2062794Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
    Uniprot Q980A5 207-320
  8. 2062807Domain d4m0ld2: 4m0l D:207-320 [253718]
    Other proteins in same PDB: d4m0la1, d4m0la3, d4m0lb1, d4m0lb3, d4m0lc1, d4m0lc3, d4m0ld1, d4m0ld3, d4m0le1, d4m0le3, d4m0lf1, d4m0lf3
    automated match to d2qn6a1
    protein/RNA complex; complexed with gdp, mg, po4

Details for d4m0ld2

PDB Entry: 4m0l (more details), 2.6 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
PDB Compounds: (D:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m0ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m0ld2 b.43.3.1 (D:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d4m0ld2:

Click to download the PDB-style file with coordinates for d4m0ld2.
(The format of our PDB-style files is described here.)

Timeline for d4m0ld2: