Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries) Uniprot Q980A5 207-320 |
Domain d4m0lc2: 4m0l C:207-320 [253715] Other proteins in same PDB: d4m0la1, d4m0la3, d4m0lb1, d4m0lb3, d4m0lc1, d4m0lc3, d4m0ld1, d4m0ld3, d4m0le1, d4m0le3, d4m0lf1, d4m0lf3 automated match to d2qn6a1 protein/RNA complex; complexed with gdp, mg, po4 |
PDB Entry: 4m0l (more details), 2.6 Å
SCOPe Domain Sequences for d4m0lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m0lc2 b.43.3.1 (C:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d4m0lc2: