Lineage for d4m0lc1 (4m0l C:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867269Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 2867278Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
    Uniprot Q980A5 2-206
  8. 2867288Domain d4m0lc1: 4m0l C:2-206 [253714]
    Other proteins in same PDB: d4m0la2, d4m0la3, d4m0lb2, d4m0lb3, d4m0lc2, d4m0lc3, d4m0ld2, d4m0ld3, d4m0le2, d4m0le3, d4m0lf2, d4m0lf3
    automated match to d2qn6a3
    protein/RNA complex; complexed with gdp, mg, po4

Details for d4m0lc1

PDB Entry: 4m0l (more details), 2.6 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
PDB Compounds: (C:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m0lc1:

Sequence, based on SEQRES records: (download)

>d4m0lc1 c.37.1.8 (C:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records): (download)

>d4m0lc1 c.37.1.8 (C:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhtiklgyaetnigvcesckkpeayv
tepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqt
rehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhki
nidsliegieeyiktpy

SCOPe Domain Coordinates for d4m0lc1:

Click to download the PDB-style file with coordinates for d4m0lc1.
(The format of our PDB-style files is described here.)

Timeline for d4m0lc1: