Lineage for d4m0lb3 (4m0l B:321-415)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544755Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1544828Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 1544837Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
    Uniprot Q980A5 321-415
  8. 1544848Domain d4m0lb3: 4m0l B:321-415 [253713]
    Other proteins in same PDB: d4m0la1, d4m0la2, d4m0lb1, d4m0lb2, d4m0lc1, d4m0lc2, d4m0ld1, d4m0ld2, d4m0le1, d4m0le2, d4m0lf1, d4m0lf2
    automated match to d2qn6a2
    protein/RNA complex; complexed with gdp, mg, po4

Details for d4m0lb3

PDB Entry: 4m0l (more details), 2.6 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdp
PDB Compounds: (B:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4m0lb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m0lb3 b.44.1.1 (B:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d4m0lb3:

Click to download the PDB-style file with coordinates for d4m0lb3.
(The format of our PDB-style files is described here.)

Timeline for d4m0lb3: