Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries) |
Domain d4lnnj1: 4lnn J:2-104 [253650] Other proteins in same PDB: d4lnna2, d4lnnb2, d4lnnc2, d4lnnd2, d4lnne2, d4lnnf2, d4lnng2, d4lnnh2, d4lnni2, d4lnnj2, d4lnnk2, d4lnnl2 automated match to d4lnia1 complexed with mg, so4 |
PDB Entry: 4lnn (more details), 3.1 Å
SCOPe Domain Sequences for d4lnnj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnnj1 d.15.9.0 (J:2-104) automated matches {Bacillus subtilis [TaxId: 1423]} akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d4lnnj1: