SCOPe 2.06: Domain d4lnng1: 4lnn G:2-104

Lineage for d4lnng1 (4lnn G:2-104)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (4 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)

8. Domain d4lnng1: 4lnn G:2-104 [253644]
   Other proteins in same PDB: d4lnna2, d4lnnb2, d4lnnc2, d4lnnd2, d4lnne2, d4lnnf2, d4lnng2, d4lnnh2, d4lnni2, d4lnnj2, d4lnnk2, d4lnnl2
   automated match to d4lnia1
   complexed with mg, so4

Details for d4lnng1

PDB Entry: 4lnn, 3.1 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of apo form of GS

PDB Compounds: (G:) glutamine synthetase

SCOPe Domain Sequences for d4lnng1:

Sequence; same for both SEQRES and ATOM records:

>d4lnng1 d.15.9.0 (G:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

Timeline for d4lnng1:

• d4lnng1 first appeared in SCOPe 2.04
  
• d4lnng1 appears in SCOPe 2.05
  
• d4lnng1 appears in SCOPe 2.07
  
• d4lnng1 appears in the current release, SCOPe 2.08