Lineage for d1a0i_1 (1a0i 241-349)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463894Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (4 proteins)
  6. 463895Protein ATP-dependent DNA ligase [50310] (2 species)
  7. 463896Species Bacteriophage T7 [TaxId:10760] [50311] (1 PDB entry)
  8. 463897Domain d1a0i_1: 1a0i 241-349 [25363]
    Other proteins in same PDB: d1a0i_2

Details for d1a0i_1

PDB Entry: 1a0i (more details), 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp

SCOP Domain Sequences for d1a0i_1:

Sequence, based on SEQRES records: (download)

>d1a0i_1 b.40.4.6 (241-349) ATP-dependent DNA ligase {Bacteriophage T7}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr

Sequence, based on observed residues (ATOM records): (download)

>d1a0i_1 b.40.4.6 (241-349) ATP-dependent DNA ligase {Bacteriophage T7}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffdactinpydgwacqisymeetpdgslrhpsfvmfr

SCOP Domain Coordinates for d1a0i_1:

Click to download the PDB-style file with coordinates for d1a0i_1.
(The format of our PDB-style files is described here.)

Timeline for d1a0i_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0i_2