SCOP 1.65: Domain d1a0i_1: 1a0i 241-349

Lineage for d1a0i_1 (1a0i 241-349)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (4 proteins)

6. Protein ATP-dependent DNA ligase [50310] (2 species)

7. Species Bacteriophage T7 [TaxId:10760] [50311] (1 PDB entry)

8. Domain d1a0i_1: 1a0i 241-349 [25363]
   Other proteins in same PDB: d1a0i_2
   complexed with atp; mutant

Details for d1a0i_1

PDB Entry: 1a0i, 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp

SCOP Domain Sequences for d1a0i_1:

Sequence, based on SEQRES records:

>d1a0i_1 b.40.4.6 (241-349) ATP-dependent DNA ligase {Bacteriophage T7}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr

Sequence, based on observed residues (ATOM records):

>d1a0i_1 b.40.4.6 (241-349) ATP-dependent DNA ligase {Bacteriophage T7}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffdactinpydgwacqisymeetpdgslrhpsfvmfr

Timeline for d1a0i_1:

• d1a0i_1 first appeared (with stable ids) in SCOP 1.55
  
• d1a0i_1 appears in SCOP 1.63
  
• d1a0i_1 appears in SCOP 1.67
  
• d1a0i_1 appears in the current release, SCOPe 2.08, called d1a0ia1