Lineage for d4lmfa2 (4lmf A:117-159)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258234Protein Complement C1S component [90143] (1 species)
  7. 2258235Species Human (Homo sapiens) [TaxId:9606] [90144] (3 PDB entries)
  8. 2258239Domain d4lmfa2: 4lmf A:117-159 [253619]
    Other proteins in same PDB: d4lmfa1, d4lmfa3, d4lmfb1, d4lmfb3, d4lmfc1, d4lmfc3, d4lmfd1, d4lmfd3
    automated match to d1nt0a3
    complexed with ca, na

Details for d4lmfa2

PDB Entry: 4lmf (more details), 2.92 Å

PDB Description: c1s cub1-egf-cub2
PDB Compounds: (A:) Complement C1s subcomponent heavy chain

SCOPe Domain Sequences for d4lmfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmfa2 g.3.11.1 (A:117-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
inectdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn

SCOPe Domain Coordinates for d4lmfa2:

Click to download the PDB-style file with coordinates for d4lmfa2.
(The format of our PDB-style files is described here.)

Timeline for d4lmfa2: