Lineage for d1cknb1 (1ckn B:239-327)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14229Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (3 proteins)
  6. 14241Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species)
  7. 14242Species Chlorella virus, PBCV-1 [50309] (3 PDB entries)
  8. 14246Domain d1cknb1: 1ckn B:239-327 [25361]
    Other proteins in same PDB: d1ckna2, d1cknb2

Details for d1cknb1

PDB Entry: 1ckn (more details), 2.5 Å

PDB Description: structure of guanylylated mrna capping enzyme complexed with gtp

SCOP Domain Sequences for d1cknb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cknb1 b.40.4.6 (B:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus, PBCV-1}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf

SCOP Domain Coordinates for d1cknb1:

Click to download the PDB-style file with coordinates for d1cknb1.
(The format of our PDB-style files is described here.)

Timeline for d1cknb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cknb2